PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G197300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 225aa    MW: 24116.6 Da    PI: 9.6513
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G197300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.55.1e-12113167458
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L +el++   e+a 
  Sevir.6G197300.1.p 113 ERRRRRMVSNRESARRSRMRKQRQLSELWAQVSHLRGANRRLLDELNRALRECAD 167
                         5899*******************************************99988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.5E-9110168No hitNo description
SMARTSM003384.6E-11110174IPR004827Basic-leucine zipper domain
PfamPF001702.1E-9112166IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.818112175IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.77E-10114164No hitNo description
PROSITE patternPS000360117132IPR004827Basic-leucine zipper domain
CDDcd147022.00E-14119166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MYHHFHGEVA SLRFLSPPNA TFAAHHHMNM ALPPQAYFPP SFEPASALQD AASLLAGDSG  60
DAASFELDTV VREAATHFAG RNGSPSSGSG SDGGGGSGYQ MNAAAPAAAA DEERRRRRMV  120
SNRESARRSR MRKQRQLSEL WAQVSHLRGA NRRLLDELNR ALRECADARR EGARLRDEKA  180
ELAKKLEQLL KATAAPATEK SAAASSTNRS GSSEPCNNTT STSE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126133RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9766321e-106EU976632.1 Zea mays clone 985663 bZIP protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973757.11e-159PREDICTED: G-box-binding factor 1
TrEMBLK3YJL41e-125K3YJL4_SETIT; Uncharacterized protein
STRINGSi014433m1e-124(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-08basic leucine-zipper 58